PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_019785-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 314aa    MW: 35363.6 Da    PI: 8.0438
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_019785-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-173077148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEdell+ ++k+ G g+W+t +++ g+ R++k+c++rw +yl
    NNU_019785-RA 30 RGPWTPEEDELLASYIKREGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 77
                     89******************************99************97 PP

2Myb_DNA-binding475.8e-1588128648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
    NNU_019785-RA  88 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 128
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-222179IPR009057Homeodomain-like
PROSITE profilePS5129416.0132577IPR017930Myb domain
SuperFamilySSF466891.21E-2827124IPR009057Homeodomain-like
SMARTSM007174.5E-132979IPR001005SANT/Myb domain
PfamPF002499.1E-163077IPR001005SANT/Myb domain
CDDcd001672.18E-103277No hitNo description
PROSITE profilePS5129424.39778132IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2480133IPR009057Homeodomain-like
SMARTSM007172.7E-1382130IPR001005SANT/Myb domain
PfamPF002499.6E-1488128IPR001005SANT/Myb domain
CDDcd001675.45E-1188128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MRNPSSSAAV AAASSSTSKT PCCSKVGLKR GPWTPEEDEL LASYIKREGE GRWRTLPKRA  60
GLLRCGKSCR LRWMNYLRPS VKRGQIAPDE EDLILRLHRL LGNRWSLIAG RIPGRTDNEI  120
KNYWNTHLSK KLINQGIDPR THKPLNPNPN SSEENVHAAP PAPKLQPHPN PNPVPRLCSG  180
ATTPYKGKEC FREMSLDQDQ SREVGKDEEN WQNSDGFIIG NNHGEDNIDC CTDEVFSSFL  240
NSLINEDMFG NQQQHQQHQQ LQPNHHLIAP PDHLVSSAQA FGYGAIWESP LTSSTAAFSQ  300
DEHKRFVDHV DKRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-25281325108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276363.10.0PREDICTED: transcription repressor MYB5-like
SwissprotQ388501e-88MYB5_ARATH; Transcription repressor MYB5
TrEMBLH9TZS91e-122H9TZS9_9R
STRINGVIT_08s0007g07230.t011e-117(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.15e-80myb domain protein 5